<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18730
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERLGGGLGVASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD |
| Length | 270 |
| Position | Middle |
| Organism | Macaca nemestrina (Pig-tailed macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.622 |
| Instability index | 50.01 |
| Isoelectric point | 5.02 |
| Molecular weight | 29775.12 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP18730
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 104.57| 27| 28| 55| 81| 1
---------------------------------------------------------------------------
29- 49 (30.78/20.21) RLLSALE...D...LEVL..SR..ELIEMLA
55- 81 (47.46/35.04) KLLQAGE...ENQVLELLI.HRDGEFQELMK
84- 112 (26.32/16.24) ..LNQGKihhEMQVLEKEVeKRDSDIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.07| 23| 23| 216| 238| 2
---------------------------------------------------------------------------
216- 238 (44.66/32.16) LAPQYPWQSNDMSMNMLPPNHSS
242- 264 (39.42/27.50) LEPPGHNKENEDDVEIMSTDSSS
---------------------------------------------------------------------------
|