| Description | Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 177 |
| Position | Unknown |
| Organism | Macaca nemestrina (Pig-tailed macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.284 |
| Instability index | 78.37 |
| Isoelectric point | 6.49 |
| Molecular weight | 18115.79 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP18719
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.99| 26| 44| 71| 97| 3
---------------------------------------------------------------------------
71- 97 (49.21/13.01) G.ANPQLRSLLLNPPPPQtGVP...PPQASL
115- 144 (47.78/10.26) GlGQPQLGPPLLHPPPAQ.SWPaqlPPRAPL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ILMDLI 2) RSLLL 3) YFEGLRKHYLL | 172 77 31 | 177 81 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab