| Description | Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPPPPGAPQGPPGTASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 187 |
| Position | Unknown |
| Organism | Macaca nemestrina (Pig-tailed macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.286 |
| Instability index | 78.98 |
| Isoelectric point | 6.16 |
| Molecular weight | 19161.92 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP18717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.06| 23| 67| 67| 103| 3
---------------------------------------------------------------------------
67- 101 (42.79/14.41) GPPPPGPILRPQNP.GanpqlrslllnpPPPQTGVP
151- 174 (40.27/ 7.16) RAPLPGQMLLSGGPrG............PVPQPGLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.81| 11| 44| 83| 93| 4
---------------------------------------------------------------------------
83- 93 (21.06/ 7.86) NPQLRSLLLNP
128- 138 (23.75/ 9.91) QPQLGPPLLHP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HYLLPAIEYF 2) LMDLI | 38 183 | 47 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab