<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18711
| Description |
Uncharacterized protein |
| Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQVIGLKQRESNVRGAGRGKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTRCSLTASPTHSTWRSSKPRFPVPRTFTPPCWTVPTRSRARHPPHLLALGWGGREWGRQWLEGGVQRE |
| Length | 189 |
| Position | Tail |
| Organism | Macaca nemestrina (Pig-tailed macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.676 |
| Instability index | 71.44 |
| Isoelectric point | 9.72 |
| Molecular weight | 20603.04 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18711
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.16| 17| 18| 19| 35| 1
---------------------------------------------------------------------------
19- 35 (35.53/11.71) GPSSAGGPGPQQQPQPP
40- 56 (32.63/10.31) GPAQSGLLQQQQQDFDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.86| 15| 16| 131| 145| 2
---------------------------------------------------------------------------
131- 145 (29.58/12.34) THSTWR.SSKPRFPVP
149- 164 (27.28/10.95) TPPCWTvPTRSRARHP
---------------------------------------------------------------------------
|