Description | Uncharacterized protein |
Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQVIGLKQRESNVRGAGRGKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTRCSLTASPTHSTWRSSKPRFPVPRTFTPPCWTVPTRSRARHPPHLLALGWGGREWGRQWLEGGVQRE |
Length | 189 |
Position | Tail |
Organism | Macaca nemestrina (Pig-tailed macaque) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.676 |
Instability index | 71.44 |
Isoelectric point | 9.72 |
Molecular weight | 20603.04 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP18711 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.16| 17| 18| 19| 35| 1 --------------------------------------------------------------------------- 19- 35 (35.53/11.71) GPSSAGGPGPQQQPQPP 40- 56 (32.63/10.31) GPAQSGLLQQQQQDFDP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.86| 15| 16| 131| 145| 2 --------------------------------------------------------------------------- 131- 145 (29.58/12.34) THSTWR.SSKPRFPVP 149- 164 (27.28/10.95) TPPCWTvPTRSRARHP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QASAA 2) RYKMLI | 7 59 | 11 64 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab