| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
| Length | 211 |
| Position | Head |
| Organism | Macaca nemestrina (Pig-tailed macaque) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.657 |
| Instability index | 56.94 |
| Isoelectric point | 9.51 |
| Molecular weight | 22254.24 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP18685
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.76| 15| 15| 31| 45| 1
---------------------------------------------------------------------------
42- 58 (31.52/ 8.77) PGKPppPPPPPPGGGPG
66- 80 (26.24/ 6.07) ATAP..PGADKSGAGCG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 14| 39| 84| 97| 3
---------------------------------------------------------------------------
84- 97 (25.31/10.32) LMRELPGSTELTGS
125- 138 (27.69/11.82) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ENFTALFG 2) QPPKKKNKHKHKQSRTQ | 19 186 | 26 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab