<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18669

Description Transducin beta like 1 X-linked
SequenceMTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATTSASVSQQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVDIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length569
PositionTail
OrganismMacaca nemestrina (Pig-tailed macaque)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca.
Aromaticity0.07
Grand average of hydropathy-0.348
Instability index40.98
Isoelectric point6.05
Molecular weight61901.37
Publications

Function

Annotated function
GO - Cellular Component
histone deacetylase complex	GO:0000118	IEA:Ensembl
mitotic spindle	GO:0072686	IEA:Ensembl
transcription repressor complex	GO:0017053	IEA:Ensembl
GO - Biological Function
beta-catenin binding	GO:0008013	IEA:Ensembl
histone binding	GO:0042393	IEA:Ensembl
protein C-terminus binding	GO:0008022	IEA:Ensembl
protein domain specific binding	GO:0019904	IEA:Ensembl
transcription corepressor activity	GO:0003714	IEA:Ensembl
transcription factor binding	GO:0008134	IEA:Ensembl
transcription regulatory region sequence-specific DNA binding	GO:0000976	IEA:Ensembl
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:Ensembl
positive regulation of canonical Wnt signaling pathway	GO:0090263	IEA:Ensembl
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:Ensembl
proteolysis	GO:0006508	IEA:Ensembl
sensory perception of sound	GO:0007605	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18669
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     371.68|      40|      40|     377|     416|       1
---------------------------------------------------------------------------
  220-  249 (34.49/18.69)	..............LRGHESE...........VFICAWNPVS.........dlL.ASGS.GDSTAR
  268-  305 (43.71/25.87)	HCirEGGHDVP..S....NKD...........VTSLDWNTNG.........tlL.ATGS.YDGFAR
  306-  335 (32.60/17.21)	I...WTEDGNLASTLGQHKGP...........IFALKWNRKG..........nY............
  336-  387 (41.73/24.33)	IL..SAGVDKTTIIWDAHTGEakqqfpfhsapALDVDWQ..........nnmtF.ASCS.TDMCIH
  388-  429 (61.96/40.10)	VC..RLGCDRPVKTFQGHTNE...........VNAIKWDPSG.........mlL.ASCS.DDMTLK
  430-  480 (58.11/37.09)	IW..SMKQEVCIHDLQAHNKE...........IYTIKWSPTGpatsnpnsnimL.ASAS.FDSTVR
  484-  522 (51.95/32.29)	IE..RGVC...THTLTKHQEP...........VYSVAFSPDG..........rYlASGS.FDKCVH
  523-  564 (47.13/28.54)	IW..NTQSGNLVHSYRG.TGG...........IFEVCWNARG........dkvG.ASASdGSVCV.
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18669 with Med16 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) AAAATTSASVSQQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVDIPSSKA
165
217

Molecular Recognition Features

MoRF SequenceStartStop
NANANA