<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18657
Description |
Uncharacterized protein |
Sequence | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLLDHKPSGHPCVRPPQPRGNLTSEELSRCRECVCVCVCVCVCVYIL |
Length | 137 |
Position | Tail |
Organism | Macaca nemestrina (Pig-tailed macaque) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.048 |
Instability index | 42.49 |
Isoelectric point | 8.42 |
Molecular weight | 15543.08 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18657
No repeats found
No repeats found
|