<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18617
| Description |
Mediator complex subunit 1 |
| Sequence | MVACLQSQLLGETESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGAVRSLYSS |
| Length | 102 |
| Position | Middle |
| Organism | Mandrillus leucophaeus (Drill) (Papio leucophaeus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Mandrillus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.283 |
| Instability index | 68.02 |
| Isoelectric point | 9.62 |
| Molecular weight | 11456.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18617
No repeats found
No repeats found
|