<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18602
| Description |
Mediator complex subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFECIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEEINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 152 |
| Position | Head |
| Organism | Mandrillus leucophaeus (Drill) (Papio leucophaeus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Mandrillus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.473 |
| Instability index | 66.03 |
| Isoelectric point | 6.83 |
| Molecular weight | 16733.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.76| 15| 16| 79| 93| 2
---------------------------------------------------------------------------
79- 93 (23.46/16.65) QKPEQVIKEDVSELR
97- 111 (23.31/16.51) QRKDALVQKHLTKLR
---------------------------------------------------------------------------
|