<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18601
| Description |
Mediator complex subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFECSCLCTELLRELPLGLDYPYGEYRENQSLPSGSVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEEINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 188 |
| Position | Head |
| Organism | Mandrillus leucophaeus (Drill) (Papio leucophaeus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Mandrillus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.468 |
| Instability index | 64.56 |
| Isoelectric point | 5.44 |
| Molecular weight | 20764.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP18601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.76| 15| 15| 115| 129| 1
---------------------------------------------------------------------------
115- 129 (23.46/15.76) QKPEQVIKEDVSELR
133- 147 (23.31/15.63) QRKDALVQKHLTKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.22| 27| 143| 12| 43| 2
---------------------------------------------------------------------------
12- 43 (44.88/27.59) QPPGPPQAppglpGQASLLQAAPGAPRPSNST
162- 188 (48.34/19.96) KPADIPQG.....SLAYLEQASANIPAPLKPT
---------------------------------------------------------------------------
|