<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18590
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWWRVPLSYP |
Length | 156 |
Position | Tail |
Organism | Mandrillus leucophaeus (Drill) (Papio leucophaeus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Mandrillus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.134 |
Instability index | 76.47 |
Isoelectric point | 8.69 |
Molecular weight | 17403.29 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18590
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.00| 22| 32| 58| 79| 1
---------------------------------------------------------------------------
36- 56 (29.03/12.15) .PS.QLL.IPSLDWLPASDGLVSR
58- 79 (39.65/18.79) QPK.QPL.RLQFGRAPTLPGSAAT
91- 114 (33.32/14.84) QPKiDHLrRLHLGACPTEECKACT
---------------------------------------------------------------------------
|