<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18587

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHREAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVGESPGRLREALVTRQLKRATAVPSPRPHSFPRGLALAFHDGSVHIVHRLSLQTMAVFYSSATPRPVDEPAIKRPRTAGPAVHFKAMQLSWTSLALVGIDNQGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICAKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGHGPDACVTSRAAEEAPAFVQLGPWPTYRPPRTPRSLDHPPGHPK
Length854
PositionTail
OrganismMandrillus leucophaeus (Drill) (Papio leucophaeus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Mandrillus.
Aromaticity0.06
Grand average of hydropathy-0.035
Instability index51.40
Isoelectric point8.31
Molecular weight94392.52
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP18587
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.54|      16|      37|     729|     744|       1
---------------------------------------------------------------------------
  729-  744 (29.22/15.64)	RLQFGRAPTLPGSAAT
  764-  779 (32.32/18.08)	RLHLGACPTEECKACT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.99|      19|      37|     425|     445|       2
---------------------------------------------------------------------------
  425-  445 (30.68/22.29)	GIDNQGKLsvLRLSPSMGHPL
  465-  483 (38.31/22.05)	GYDWWDIL..LHVQPSMVQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.24|      27|     133|      22|      48|       3
---------------------------------------------------------------------------
   22-   48 (53.17/33.28)	EKWSKSTHCPSVPLACAWSCRNLIAFT
  157-  183 (49.06/30.08)	EKFSRVKFSPSLTLFGGKPMEGWIAVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.87|      14|      32|     110|     123|       4
---------------------------------------------------------------------------
  110-  123 (26.43/16.06)	MADHLANSWESSVG
  143-  156 (22.44/12.53)	LALHVEKSGASSFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.02|      21|      32|     672|     693|       5
---------------------------------------------------------------------------
  672-  693 (36.09/24.57)	LLTKL.WICCRDeGPAS..EPDEAL
  705-  728 (29.93/15.21)	LIPSLdWLPASD.GLVSrlQPKQPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     114.88|      37|     190|     301|     358|       8
---------------------------------------------------------------------------
  306-  355 (50.59/66.91)	VECWSLRKeglpVNNIFqqispVGESPgrlrEALVT.RQLKRATAV......PSPRP
  796-  839 (64.30/29.23)	VKQWEQRW....IKNCL.....CGHGP....DACVTsRAAEEAPAFvqlgpwPTYRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.38|      30|      38|     584|     613|      10
---------------------------------------------------------------------------
  584-  613 (51.08/29.55)	FVLDMNTLQALQQLLQWVGDFVLYLLASLP
  625-  654 (53.29/31.12)	FLRDGTSLGMLRELMVVIRIWGLLKPSCLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP18587 with Med16 domain of Kingdom Metazoa
Unable to open file!