<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18531
Description |
Uncharacterized protein |
Sequence | IDLLKEHQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLKQQVIATATVYFKRSYARYSLKSIDLVLMAPTCLFLASKLRNLENFPRMNHILECEFYLLQLMDCCLIVYHPYSPLLQHVQDVGQEDMLLPLAWRIVNDTYRMDLCLLYPLFMIALACLRVACVVQQKDARQWFAELPVDIEKILEIIRVILKLYEQWKNFDERKEMATILSKLPKPKPPPNSEGEQIFMFNSSYI |
Length | 235 |
Position | Kinase |
Organism | Cebus capucinus imitator |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Cebinae> Cebus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.037 |
Instability index | 47.80 |
Isoelectric point | 6.59 |
Molecular weight | 27826.58 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP18531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.99| 21| 21| 37| 57| 1
---------------------------------------------------------------------------
37- 57 (34.23/24.00) LKLKQQVIATATVYFKRSYAR
60- 80 (34.76/24.46) LKSIDLVLMAPTCLFLASKLR
---------------------------------------------------------------------------
|