<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18510
Description |
Uncharacterized protein |
Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPTQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 181 |
Position | Unknown |
Organism | Cebus capucinus imitator |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Cebinae> Cebus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.256 |
Instability index | 74.52 |
Isoelectric point | 5.61 |
Molecular weight | 18758.40 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18510
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.41| 22| 23| 88| 109| 1
---------------------------------------------------------------------------
73- 105 (38.97/ 6.83) NPGAnpqlrslllnpPPPQTGVPPPQASLHHLQ
106- 131 (39.45/ 7.00) PPGA.......pallPPPHQGLGQPQLGPPLLH
---------------------------------------------------------------------------
|