<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18488

Description Mediator complex subunit 14
SequenceMAPVQLENHQLVPPGGGGGSSGGPQSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTICSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNASDREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKRSGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGISEETQKALDRCLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGASSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP
Length1418
PositionTail
OrganismCebus capucinus imitator
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Cebinae> Cebus.
Aromaticity0.06
Grand average of hydropathy-0.188
Instability index52.70
Isoelectric point8.97
Molecular weight156506.98
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
stem cell population maintenance	GO:0019827	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18488
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     236.63|      32|      32|    1065|    1096|       1
---------------------------------------------------------------------------
  966-  987 (26.76/ 8.20)	.PPPQQQPF.PKQ.PGTS.GA..YPLTS............
  999- 1028 (39.68/16.10)	SPSMMHTQS.PGNlHAAS.SP..SGALRAP...SPAS...
 1032- 1060 (31.35/11.00)	TP.......pPSS.HGISiGPgaSFASPHG.TLDPSS..P
 1065- 1096 (65.47/31.87)	SPSGRAGNW.PGS.PQVS.GP..SPATRMP.GMSPAN..P
 1100- 1129 (39.46/15.97)	SPVPDASH....S.PR.A.GA..SSQT.MPtNMPPPRklP
 1151- 1176 (33.91/12.57)	LPSPTPGLV.PGL.AGSY.LC..SPLERFL.G........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.06|      24|      24|    1327|    1350|       2
---------------------------------------------------------------------------
 1326- 1349 (39.65/17.57)	KMLFFL..QLTQKTSVPPQEPVSIIV
 1350- 1375 (34.41/14.31)	PIIYDMasGTTQQADIPRQQNSSVAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.16|      28|      32|     473|     504|       3
---------------------------------------------------------------------------
  473-  504 (43.46/32.87)	IKHLPT..ICSETLQLSNYSTHpignLSKNKLFI
  506-  535 (45.71/24.67)	LTRLPQyyIVVEMLEVPNKPTQ....LSYKYYFM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.27|      32|      32|      66|      97|       4
---------------------------------------------------------------------------
   66-   97 (51.36/38.14)	LMVLTDLLPRKSDVERKIEIVQFASRTRQLFV
   99-  130 (52.92/39.54)	LLALVKWANNAGKVEKCAMISSFLDQQAILFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.11|      12|      33|     254|     267|       8
---------------------------------------------------------------------------
  254-  267 (17.70/18.01)	VEDKETGDsfCLSL
  290-  301 (23.41/15.04)	VERYHAGK..CLSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.60|      14|      37|    1211|    1225|       9
---------------------------------------------------------------------------
 1211- 1225 (21.47/21.30)	LKCRVALSP.KTNqTL
 1249- 1263 (22.14/15.04)	FETRVAGPPfKAN.TL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.21|      14|      29|     168|     181|      10
---------------------------------------------------------------------------
  168-  181 (26.56/15.20)	RLPTCIRDKII....PPD
  194-  211 (19.65/ 9.21)	QLNQILRHRLVttdlPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.75|      12|      29|     323|     334|      11
---------------------------------------------------------------------------
  323-  334 (20.47/15.75)	IKIDENDVSKPL
  354-  365 (20.28/15.51)	MKIDHLSIEKLL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18488 with Med14 domain of Kingdom Metazoa

Unable to open file!