<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18467
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHLGSAEAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGPGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPSMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Cebus capucinus imitator |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Cebinae> Cebus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.013 |
| Instability index | 62.61 |
| Isoelectric point | 9.81 |
| Molecular weight | 28136.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18467
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.36| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (37.63/10.94) PPP.....PPTALGFGPGKPP
61- 81 (31.73/ 8.22) PPPtaataPPGADKSGPGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.52| 31| 46| 85| 115| 2
---------------------------------------------------------------------------
85- 115 (57.27/27.28) MRELPGSTELTGSTN......LITHYN.LEQAYNKFCG
126- 163 (47.25/21.51) LPDLPGMIDLPGSHDnsslrsLIEKPPiLSSSFNPITG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.00| 16| 17| 207| 222| 3
---------------------------------------------------------------------------
187- 200 (25.56/10.12) P..PKKKNKHKHKQSR
207- 222 (27.84/11.58) PETPSDSDHKKKKKKK
226- 241 (26.60/10.79) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
|