<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18454
| Description |
Uncharacterized protein |
| Sequence | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLTAAATSVCKCKKYISPEYISFFFVCL |
| Length | 134 |
| Position | Kinase |
| Organism | Cebus capucinus imitator |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Cebinae> Cebus.
|
| Aromaticity | 0.16 |
| Grand average of hydropathy | 0.046 |
| Instability index | 45.42 |
| Isoelectric point | 9.05 |
| Molecular weight | 15699.17 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18454
No repeats found
No repeats found
|