<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18446
| Description |
Uncharacterized protein |
| Sequence | MAAPLGGMFSGQPPGPPQPPPGLPGQPSLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVSGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDISVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 178 |
| Position | Head |
| Organism | Cebus capucinus imitator |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Cebinae> Cebus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.475 |
| Instability index | 63.20 |
| Isoelectric point | 5.39 |
| Molecular weight | 19544.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18446
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 62.80| 16| 16| 117| 132| 1
---------------------------------------------------------------------------
100- 114 (15.98/ 9.00) .LQLSVQ.KPEQVIKED
117- 132 (24.89/17.86) ELRNELQ.RKDALVQKH
135- 150 (21.93/14.91) KLRHWQQvLEDISVQ.H
---------------------------------------------------------------------------
|