<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18389
| Description |
Mediator complex subunit 9 |
| Sequence | MASAGVAAGRQAEDALPPMSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEDNYSFLPLVHSIIKCRDGAGLK |
| Length | 82 |
| Position | Middle |
| Organism | Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Cercocebus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.718 |
| Instability index | 99.30 |
| Isoelectric point | 6.53 |
| Molecular weight | 8651.74 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18389
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.27| 14| 16| 23| 36| 1
---------------------------------------------------------------------------
17- 34 (26.11/ 6.82) PPmsdqPLPDTKPLPPPQ
35- 52 (26.16/ 6.85) PPpvpaPQPQQSPAPRPQ
---------------------------------------------------------------------------
|