<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18373
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK |
| Length | 131 |
| Position | Middle |
| Organism | Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Cercocebus.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.644 |
| Instability index | 31.34 |
| Isoelectric point | 8.72 |
| Molecular weight | 15804.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | limb development GO:0060173 IEA:Ensembl
negative regulation of fibroblast proliferation GO:0048147 IEA:Ensembl
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18373
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 22| 65| 1
---------------------------------------------------------------------------
22- 63 (48.15/50.86) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKdpEY
67- 108 (57.96/29.78) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQ..HY
---------------------------------------------------------------------------
|