<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18338
| Description |
Uncharacterized protein |
| Sequence | MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQDWPGAGSSADQDDEEEVSVDWNV |
| Length | 91 |
| Position | Head |
| Organism | Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Cercocebus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.641 |
| Instability index | 66.38 |
| Isoelectric point | 4.05 |
| Molecular weight | 9728.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18338
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.18| 16| 17| 54| 70| 1
---------------------------------------------------------------------------
54- 70 (23.94/13.65) GSEEEEAAGTEGDAqDW
74- 89 (28.24/12.44) GSSADQDDEEEVSV.DW
---------------------------------------------------------------------------
|