<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18327
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPSSVQCGALDSSIPLKKKPMYCGLLGLGTGTVAAPLYPFWPFGQKQLP |
| Length | 257 |
| Position | Head |
| Organism | Colobus angolensis palliatus (Peters' Angolan colobus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Colobus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.507 |
| Instability index | 53.46 |
| Isoelectric point | 9.51 |
| Molecular weight | 27115.98 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18327
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.50| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (34.12/ 9.15) PPPPPTALGFGPGKPP
48- 63 (37.39/10.70) PPPPPPGGGPGTAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.62| 16| 18| 203| 218| 2
---------------------------------------------------------------------------
188- 203 (25.74/10.97) PKKKNKHKHKQSRTQD
204- 219 (29.20/13.37) PVPPGKPSSVQCGALD
220- 234 (20.68/ 7.45) SSIPLKKKPMYCGLL.
---------------------------------------------------------------------------
|