<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18318
| Description |
Uncharacterized protein |
| Sequence | MLSSNAERRSCDALPPFFARKMAASQQQASAASSAAGVSGSSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
| Length | 201 |
| Position | Tail |
| Organism | Colobus angolensis palliatus (Peters' Angolan colobus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Colobus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.375 |
| Instability index | 82.07 |
| Isoelectric point | 6.80 |
| Molecular weight | 21272.91 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18318
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.06| 19| 19| 40| 58| 1
---------------------------------------------------------------------------
40- 58 (36.63/16.11) GSSSAGGPGPQQQPQPPAQ
61- 79 (34.43/14.74) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.06| 28| 101| 11| 38| 2
---------------------------------------------------------------------------
11- 38 (49.18/30.35) CDALP.PFFARKMA...ASQQQASAASSAAGV
114- 142 (40.22/23.51) CDQLE...LCLRLAhecLSQSCDSAKHSPTLV
153- 172 (22.66/10.10) PDSLPyPQY...LA...VIKAQISCA......
---------------------------------------------------------------------------
|