<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18229
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNARHLGSVAEGMMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGTDKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 260 |
Position | Head |
Organism | Aotus nancymaae (Ma's night monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.979 |
Instability index | 62.29 |
Isoelectric point | 9.86 |
Molecular weight | 28039.82 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP18229
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 127.82| 32| 115| 115| 146| 1
---------------------------------------------------------------------------
83- 99 (21.56/ 7.63) ..........LMRELPGSTELTGSTN......L
115- 146 (58.86/32.28) KKVKEKLSN.FLPDLPGMIDLPGSHDNSSLRSL
231- 259 (47.40/24.70) KKEKKKKKNrHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.53| 21| 27| 32| 56| 2
---------------------------------------------------------------------------
32- 56 (44.36/17.29) PPPTAlgfgPGKPPPPPPPPPGGGP
60- 80 (44.17/11.55) PPPTA....ATAPPGTDKSGAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.86| 16| 16| 186| 201| 3
---------------------------------------------------------------------------
186- 201 (28.50/13.87) PPK...KKNKHKHKQSRTQ
205- 223 (21.35/ 8.74) PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------
|