<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18198
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSGVRAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGAEGDAQDWAGAGSSADQDDDEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLMSKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQSPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPNLQLSISLCHSSNDKKSQKFATEKQSPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRSRTAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKCHSTRYMQFSSSPRLWAGRY |
| Length | 509 |
| Position | Head |
| Organism | Aotus nancymaae (Ma's night monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.508 |
| Instability index | 57.71 |
| Isoelectric point | 7.65 |
| Molecular weight | 57161.29 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18198
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 151.50| 35| 100| 125| 159| 2
---------------------------------------------------------------------------
125- 159 (59.33/32.11) MTLDPVSQDALP.PKQNPQTLQLMSKKKSLAGAAQI
230- 257 (48.19/24.90) LDLD....KKIP.EDYCPLDVQIPS...DLEGSAYI
269- 299 (43.98/22.16) GDLGTVNLFKRPlPKSKPGSPHWQTKLE....AAQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.09| 33| 146| 312| 348| 3
---------------------------------------------------------------------------
312- 348 (54.73/47.59) SR.EAVQIKSQIPHI......VVKNQIISQPFPnlqlSISLCHS
453- 492 (52.36/35.51) SRiEDPQIQAHWSNIndvyesSVKVLITSQGYE....QICKCHS
---------------------------------------------------------------------------
|