<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18174
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPTQLPPRAPLPGQMLMSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 177 |
| Position | Unknown |
| Organism | Aotus nancymaae (Ma's night monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.295 |
| Instability index | 79.34 |
| Isoelectric point | 6.49 |
| Molecular weight | 18133.83 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18174
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.11| 26| 44| 71| 97| 3
---------------------------------------------------------------------------
60- 91 (43.58/11.27) PPGPIL............rpqnpG.ANPQLRSLLLNPPPPQtGVP
92- 135 (40.52/ 7.76) PPQASLhhlqppgapallppphqGlGQPQLGPPLLHPPPAQ.SWP
---------------------------------------------------------------------------
|