<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18170

Description Mediator complex subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKPPPASQPSLVSTVAPGSGLAPAAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQQRGMGGQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQSTAQPPPGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPTQLPPRAPLPGQMLMSGGPRGPVPQPGLQPSVMEDDILMDLI
Length534
PositionUnknown
OrganismAotus nancymaae (Ma's night monkey)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae> Aotus.
Aromaticity0.04
Grand average of hydropathy-0.337
Instability index61.17
Isoelectric point9.40
Molecular weight55455.98
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18170
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     178.14|      40|      44|      91|     133|       3
---------------------------------------------------------------------------
   97-  137 (79.90/17.69)	QQAAPGVGPPFSQA................PAPPLP.....PGPPGAPKPPPASQPSLvSTV
  349-  399 (48.26/ 8.27)	QQAPPGLGP.....iledqarpsqnllqlrPPQPQP.....QGTVGASGATGQPQPQS.TAQ
  483-  523 (49.98/ 8.14)	LHPPPAQSWPTQLP................PRAPLPgqmlmSGGPRGPVPQPGLQPS.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.57|      18|      24|     138|     156|       5
---------------------------------------------------------------------------
  138-  156 (32.51/13.99)	APG..SGLAPaAQPGAPSMAG
  159-  178 (30.06/ 9.40)	APGgvSGPSP.AQLGAPALGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.83|      30|      57|       2|      32|       7
---------------------------------------------------------------------------
    2-   32 (48.90/34.91)	VPGSEGPARAGGLVAdVVFVIEGTANLGPYF
   61-   90 (50.93/31.50)	VPGNLSAAQVAAQNA.VEAAKNQKAGLGPRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     117.07|      26|      26|     258|     283|       8
---------------------------------------------------------------------------
  258-  283 (45.97/29.76)	VQF.HFTNKDLESLKGLYRIMGNGFAG
  285-  311 (34.83/20.86)	VHFpHTAPCEVRVLMLLYSSKKKIFMG
  317-  333 (19.63/ 8.71)	.QS.GFVN.......GIRQVITN.HKQ
  334-  347 (16.64/ 6.32)	VQ.....QQKLEQQQ...RGMG.....
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18170 with Med25 domain of Kingdom Metazoa

Unable to open file!