Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAASSSGEKEKERLGGGLGVASGSSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLSVNQGKIHHEMQVLEKEVEKRDSDIQQLQNQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIINYAHRISASNAVCAPLTWVPGDPRRSYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDYPWQSNDMSMNMLPPNHSSDFLLEPPGHSKENEDDVEIMSTDSSSSSSESD |
Length | 265 |
Position | Middle |
Organism | Aotus nancymaae (Ma's night monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae> Aotus. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.634 |
Instability index | 48.93 |
Isoelectric point | 4.91 |
Molecular weight | 29176.26 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP18156 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.34| 12| 24| 25| 36| 1 --------------------------------------------------------------------------- 25- 36 (19.54/11.38) STRERLLSALED 51- 62 (18.80/10.71) SRNQKLLQAGEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 84.89| 23| 24| 94| 117| 2 --------------------------------------------------------------------------- 64- 90 (34.02/22.61) QVLELLI.HRDGEFQELMklsvNQGKIH 94- 117 (33.99/27.71) QVLEKEVeKRDSDIQQLQ....NQLKEA 119- 133 (16.88/ 8.03) QILATAV.......YQAK....EKLK.. --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPPGHSKENEDDVEIMSTD 2) GRLPDYPWQ | 238 210 | 256 218 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab