<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18156
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERLGGGLGVASGSSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLSVNQGKIHHEMQVLEKEVEKRDSDIQQLQNQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIINYAHRISASNAVCAPLTWVPGDPRRSYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDYPWQSNDMSMNMLPPNHSSDFLLEPPGHSKENEDDVEIMSTDSSSSSSESD |
| Length | 265 |
| Position | Middle |
| Organism | Aotus nancymaae (Ma's night monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.634 |
| Instability index | 48.93 |
| Isoelectric point | 4.91 |
| Molecular weight | 29176.26 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18156
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.34| 12| 24| 25| 36| 1
---------------------------------------------------------------------------
25- 36 (19.54/11.38) STRERLLSALED
51- 62 (18.80/10.71) SRNQKLLQAGEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.89| 23| 24| 94| 117| 2
---------------------------------------------------------------------------
64- 90 (34.02/22.61) QVLELLI.HRDGEFQELMklsvNQGKIH
94- 117 (33.99/27.71) QVLEKEVeKRDSDIQQLQ....NQLKEA
119- 133 (16.88/ 8.03) QILATAV.......YQAK....EKLK..
---------------------------------------------------------------------------
|