<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18143
Description |
Uncharacterized protein |
Sequence | MGGNFWQSSYYLQWILDKQDLLKEHQKDLKFLSEEYWKLQIFFTNVIQALGEHLKLRQQVIATAMVYFKRFYARYSLKSIDPVLMAPTCVFLPSKVEEFGVVSNTRLTAAATSEFPYRMNHILECEFYLLELMDCCLIVYHPYSPLLQHVQDVGQEDMLLPLPWRIVNDTYRMDLCLLYPPFMIALACLHVARVVQQKDGRQWFSELSVDIENILEIIRWKNFDERKEMATILSKMPKPKPSPNRSQTKWLIIFGPQ |
Length | 257 |
Position | Kinase |
Organism | Aotus nancymaae (Ma's night monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.095 |
Instability index | 58.44 |
Isoelectric point | 7.00 |
Molecular weight | 30397.25 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP18143
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.24| 19| 51| 117| 137| 1
---------------------------------------------------------------------------
117- 137 (32.52/27.77) YRMNHILECEFYLLELMdcCL
171- 189 (37.72/23.89) YRMDLCLLYPPFMIALA..CL
---------------------------------------------------------------------------
|