<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18142
| Description |
Uncharacterized protein |
| Sequence | MGGNFWQSSYYLQWILDKQDLLKEHQKDLKFLSEEYWKLQIFFTNVIQALGEHLKLRQQVIATAMVYFKRFYARYSLKSIDPVLMAPTCVFLPSKVEEFGVVSNTRLTAAATSEFPYRMNHILECEFYLLELMDCCLIVYHPYSPLLQHVQDVGQEDMLLPLPWRIVNDTYRMDLCLLYPPFMIALACLHVARVVQQKDGRQWFSELSVDIENILEIIRWKNFDERKEMATILSKMPKPKPSPNSEGEQGPNGSENFSKLQPILKHSEEFHSGPRGNKHRTDFSNVLSGTE |
| Length | 291 |
| Position | Kinase |
| Organism | Aotus nancymaae (Ma's night monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.281 |
| Instability index | 53.94 |
| Isoelectric point | 6.16 |
| Molecular weight | 33990.86 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18142
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.24| 19| 51| 117| 137| 1
---------------------------------------------------------------------------
117- 137 (32.52/32.11) YRMNHILECEFYLLELMdcCL
171- 189 (37.72/27.65) YRMDLCLLYPPFMIALA..CL
---------------------------------------------------------------------------
|