<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18135
| Description |
Mediator complex subunit 9 |
| Sequence | MASAGVAAGRQAEDALPPTSDQPLPDNKPLPPPQPPPPVAAPQPQQSPAPRPQSPARAREEENYSFLPLVHNIIKCSLQ |
| Length | 79 |
| Position | Middle |
| Organism | Aotus nancymaae (Ma's night monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Aotidae>
Aotus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.742 |
| Instability index | 117.07 |
| Isoelectric point | 5.62 |
| Molecular weight | 8377.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18135
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.27| 17| 17| 17| 33| 1
---------------------------------------------------------------------------
17- 33 (35.85/10.07) PPTSDQPLPDNKPLPPP
36- 52 (35.41/ 9.87) PPPVAAPQPQQSPAPRP
---------------------------------------------------------------------------
|