Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MHPPASENLADFIARVNAQPSGFRSVTEEKLREDIRARQDTNGAARDEDADMSDEDEAAPKDPNVARMEVLKNIDIAGNTTLLTLDFLSLLLSKQNPTQASLTLSPQLRDMVGIGTLGADKLDEANTNEAKTKDQEQVALGWTLMEINRTRDAAVKASSLLEREVETESRYWEDVMAVKKVAASPEFKNNGLAPMRRSDDGSVELDLGRLGGVSEGLVVTYEKDGKVVGRSVPRRRTSHDLSLESRVLEARNTIFSQELWHELTRESRTLASYNVWLQGSRLTCELDRSSRITVELLPLASCPLPDDTLPESSTAEMMSASLHLLLSYAHRYNELMRTRPIPPHLSRSRGQQTYALLRPIIARMKSILSIQSCTRYVGDLAKVLQNAGFAASFTLHTPQLSAIEPGVSGPNQPSGAQTFVRNMMQPLEFTVELIILPELSLTIRGRTFIFPVTATYYHVLLPPQSPLQGFAAPYADGYSDLGGLSDYLQIAVARSLAAHSLARLSETHSGTEWTPNMMGTSFRDPDRENGEIHFAVQEEPDAGLALILSSAAVASQRRQQRTWKWRSGGSGESMTLEEAVNEAVGTSASSEKSRC |
Length | 595 |
Position | Head |
Organism | Tolypocladium capitatum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.379 |
Instability index | 50.91 |
Isoelectric point | 5.38 |
Molecular weight | 65539.07 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP18116 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.77| 13| 15| 253| 265| 1 --------------------------------------------------------------------------- 253- 265 (24.97/15.94) TIFSQELW.......HELTR 269- 288 (18.79/10.45) TLASYNVWlqgsrltCELDR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 31.21| 10| 15| 204| 214| 2 --------------------------------------------------------------------------- 204- 214 (13.51/12.41) ELDlGRLGGVS 222- 231 (17.70/10.66) EKD.GKVVGRS --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) FRSVTEEKLREDIRARQDTNGAARDEDADMSDEDEAAPKDPNVARMEV | 23 | 70 |
MoRF Sequence | Start | Stop |
1) NLADFIARVN 2) RTWKWRSGG | 8 561 | 17 569 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab