Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSSQVAQDAPMASSPPPVPPPAPSDSEPLYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLAYLRYWTRPPYLKYLTYPGPTLRHLELLQQERFRQDVMSPDLVQRLVEEEMRASVQWHREP |
Length | 131 |
Position | Middle |
Organism | Tolypocladium capitatum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.459 |
Instability index | 84.95 |
Isoelectric point | 5.56 |
Molecular weight | 15179.11 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP18104 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.07| 16| 28| 40| 55| 1 --------------------------------------------------------------------------- 40- 55 (28.61/13.23) LEFVQSLANPFYLNHL 70- 85 (31.46/15.08) LAYLRYWTRPPYLKYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LAYLRYW 2) PLYGGYSRFEI 3) YLKYLTY | 70 28 81 | 76 38 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab