<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18095
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQHQIVQSPARLGLTNPNSPLIPNPTPPKLPPLQTTHHHQDRHTAAPSAALLSLLPPLPRAQALLVQMASLSSKLFEVSPNKSLWVSAFRGSLPTFLSSQGQPHSSASLDSSPSSIKEILSLFSILQIQIFEAVSELQEILDQQDAKQKIDQEICSKDSSLLAFANKLKDAERVLDILVDDYSDYRSNTKRLKLGDGSEDDSLTTSSVSSKLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDIGLPKEVDTKEKTIEAIIEPPPLQPVDTNSLANLPGIQGLLPPNFTIPPGWKPGMPVQLPIDIPIKPPAGWKPGDPVALPPMDSLPVQRFDEQQLRPHVPQLKQPEIIQVAPVNLDLGGSDSSDYSSDDASTDDED |
| Length | 403 |
| Position | Middle |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.356 |
| Instability index | 61.88 |
| Isoelectric point | 4.85 |
| Molecular weight | 43819.07 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18095
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.40| 17| 18| 308| 324| 1
---------------------------------------------------------------------------
291- 306 (22.96/ 8.35) QPVD.TN.SL.ANLPGIQG
308- 324 (37.75/18.55) LPPNFTI.PP.GWKPGMPV
326- 344 (26.69/10.92) LPIDIPIkPPaGWKPGDPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.16| 19| 37| 3| 24| 2
---------------------------------------------------------------------------
3- 21 (32.80/12.01) QHQIVQSPARLGLTNPNSP
66- 84 (27.36/ 7.60) LVQMASLSSKLFEVSPNKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.53| 17| 22| 177| 197| 3
---------------------------------------------------------------------------
177- 197 (24.36/21.96) DilvdDYSDYRSNTKRLKLGD
201- 217 (27.18/14.73) D....DSLTTSSVSSKLKLSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.62| 19| 37| 232| 250| 4
---------------------------------------------------------------------------
232- 250 (37.57/20.41) PPEFGAGQ....APLRGALP...............PAP
252- 289 (21.05/ 8.16) DEQMRASQlynfADLDIGLPkevdtkektieaiiePPP
---------------------------------------------------------------------------
|