<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18048
| Description |
Uncharacterized protein (Fragment) |
| Sequence | YALAYFAVLSGAFAWGADSSSSASKRRPKVLGTHLEFLASALDGKISLGCDPATWRAYVSGFVSLMVGCTPNWVLEVDVNVLKRLSNGLRQLNEEELALALLGAGGVGTMGAAAELIIDTEM |
| Length | 122 |
| Position | Tail |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.383 |
| Instability index | 30.34 |
| Isoelectric point | 5.00 |
| Molecular weight | 12821.59 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18048
No repeats found
No repeats found
|