<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18046
| Description |
Mediator of RNA polymerase II transcription subunit 23-like protein |
| Sequence | MIDYMNMDERSIGMFWVVTYTMAQPACETVMSWLNSAGVTDLIPATNLQPAERLMGTREVSPLPMSLISGFSMNLCLKLSYQMEDALFSGQAVPSIAMVESYTRLLLIAPHSLFRSHFNHLVQKSPSLLSKPGATLLVLEILNYRLLPLYRYQGKSKTLMYDVTKIITALKGKRGDHRVFRLAENVCLNLIFSMRDFFLVKRDGKGPTEFTETLNRVCVITLAILIKTRGIAEAEHLLYLQSMLEQILAIGQHTWSEKTLRYFPPVLREALSGLPDKRSVAVQAWQQSMWDLNQPPYG |
| Length | 298 |
| Position | Tail |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.063 |
| Instability index | 42.73 |
| Isoelectric point | 8.97 |
| Molecular weight | 33825.31 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18046
No repeats found
|