<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18042
Description |
Mediator of RNA polymerase II transcription subunit 17-like protein |
Sequence | MDEGMELQLSLDKLPIKRLDSIEENGIERFPPDVDYDEKRTSLIRRIDFAWAIEKDEEKKKQKKSSKEPATPWQWQGMVENLQLAHQELSVIIDLINTSSPLPDKSECRSWVEQLVGRFHVGKQIVAAASTISSGNFICLAISLPLPSCNLSVKSYLSKEEKKKKGKK |
Length | 168 |
Position | Head |
Organism | Trifolium pratense (Red clover) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.580 |
Instability index | 55.43 |
Isoelectric point | 7.66 |
Molecular weight | 19125.78 |
Publications | PubMed=24500806
PubMed=28382043
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP18042
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.49| 12| 101| 53| 64| 1
---------------------------------------------------------------------------
53- 64 (20.45/ 9.86) IEKDEEKKKQKK
157- 168 (20.04/ 9.56) LSKEEKKKKGKK
---------------------------------------------------------------------------
|