<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18032
Description |
Mediator of RNA polymerase II transcription subunit 15a-like protein (Fragment) |
Sequence | ELSEMYQKIATKLQQHDSLPHQPKSDQLEKLKVFKMMLERLITFLQVSKSNISPSLKEKLGSYEKQIINFINTNRPRKLSSLQPGQLPPPHMHSMSQTQSQVTQVQLHENQMNNQLQTTNIQGPGATMQQNNMTSMQHSSLSGVSSAQQLISQIQSQLAQLQLASDEDEGDGHDEEDTGKKLGDVQDDQIHAVMKNGVKTCIVLFDVTSSSRYDSSMTVDLYLDDQHLLNVEDCNAGMNLLMCTHL |
Length | 246 |
Position | Tail |
Organism | Trifolium pratense (Red clover) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.623 |
Instability index | 46.76 |
Isoelectric point | 5.51 |
Molecular weight | 27634.87 |
Publications | PubMed=24500806
PubMed=28382043
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18032
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.65| 16| 18| 101| 117| 1
---------------------------------------------------------------------------
88- 107 (24.01/11.88) PPPHMHS.MSqtqsQVTQVQL
108- 128 (16.64/10.95) HENQMNNqLQttniQGPGATM
---------------------------------------------------------------------------
|