Description | Mediator of RNA polymerase II transcription subunit 12-like protein (Fragment) |
Sequence | RAYLNPTRRTLTDHIPEALSLAMHRMATIIASNGRVSNLGATAFTRYLLKKYSNVASVIEWEQTFKSTCDARLSAELESVRSVDGELGFPFGVPAGVEDPDEFFR |
Length | 105 |
Position | Kinase |
Organism | Trifolium pratense (Red clover) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.203 |
Instability index | 42.00 |
Isoelectric point | 6.13 |
Molecular weight | 11680.07 |
Publications | PubMed=24500806 PubMed=28382043 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP18029 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AFTRYLLKKY 2) ELESVR 3) ELGFPFGVP 4) VEDPDEFFR | 43 76 86 97 | 52 81 94 105 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab