<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18019
| Description |
Mediator of RNA polymerase II transcription subunit 21-like protein (Fragment) |
| Sequence | FDVLVASLPISETGEEAQLKRIAELQAENDAVGQELQKQLEAAEMELNQVQELYRQATDNCLNLKKPDVN |
| Length | 70 |
| Position | Middle |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.540 |
| Instability index | 37.07 |
| Isoelectric point | 4.23 |
| Molecular weight | 7841.66 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
polar nucleus GO:0043078 IEA:EnsemblPlants
|
| GO - Biological Function | |
| GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants
|
Interaction
Repeat regions
| Repeats |
>MDP18019
No repeats found
No repeats found
|