| Description | Uncharacterized protein (Fragment) |
| Sequence | VVVAILRGYALACFAVLSGTFAWGIDSSSTASKRRPKVIGIHLEFLANALDGKISLRCDCATWRAYVSGFMSLMVSCTPLWIEELDVGMLKRVSMGLRQLNEDDLALQLLEIRGASLMGEVAEMISQNGF |
| Length | 130 |
| Position | Tail |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.451 |
| Instability index | 52.79 |
| Isoelectric point | 5.79 |
| Molecular weight | 14187.50 |
| Publications | PubMed=24500806 PubMed=28382043 |
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP18013 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) TASKRRPKVIGIHLEFLA 2) VVVAILR | 30 1 | 47 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab