<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18007
| Description |
Uncharacterized protein (Fragment) |
| Sequence | IAELSNHFDKCQQLLNSISASISTKAMTVEGQKKKLEESEQLLNQRRDLVVNYTKSVEELVRSEP |
| Length | 65 |
| Position | Middle |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.629 |
| Instability index | 46.85 |
| Isoelectric point | 5.78 |
| Molecular weight | 7405.29 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18007
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.34| 10| 26| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (19.41/12.48) HFDKCQQLLN
35- 44 (15.94/ 9.34) KLEESEQLLN
---------------------------------------------------------------------------
|