<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17999
| Description |
Mediator of RNA polymerase II transcription subunit 12-like protein (Fragment) |
| Sequence | MLPLSLIFPPAYSIFAFVRWRPFILNANVAVREDMNQLYQSLTMAIADAIKHLPFRDVCFRDCQGLYDLMAADGSDAEFAALLELNSSDMHLKSMAFVPLRSRLFLNAMID |
| Length | 111 |
| Position | Kinase |
| Organism | Trifolium pratense (Red clover) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.356 |
| Instability index | 53.49 |
| Isoelectric point | 5.18 |
| Molecular weight | 12619.65 |
| Publications | PubMed=24500806
PubMed=28382043
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17999
No repeats found
|