<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17997
Description |
Mediator of RNA polymerase II transcription subunit 33A (Fragment) |
Sequence | MISFSSEPVFMDSFPKLSTWYQQHQECLASTQCALVPGGPVLQIVDALLSMMCKKINKSAQSLTSTTSGNSNSSGSSLDDALVKLKVPAWDILEAAPFVLDAALTACAHGRLSPRELAT |
Length | 119 |
Position | Tail |
Organism | Trifolium pratense (Red clover) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Trifolium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.139 |
Instability index | 48.09 |
Isoelectric point | 5.51 |
Molecular weight | 12674.43 |
Publications | PubMed=24500806
PubMed=28382043
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17997
No repeats found
No repeats found
|