<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17975
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDGRQRFLLELEFIQCLANPIYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPAPATVHPPAPVSAPSPVPAPASSLPTMSAVVASAMPPMQFIGTPGTNNSKNEMRNVMGGRKRKMG |
Length | 184 |
Position | Middle |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.441 |
Instability index | 60.69 |
Isoelectric point | 9.75 |
Molecular weight | 21147.33 |
Publications | PubMed=20148030
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17975
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.40| 15| 17| 107| 122| 1
---------------------------------------------------------------------------
107- 122 (29.65/13.81) PrPPPEPTPAPAPAPA
126- 140 (31.75/11.50) P.PAPVSAPSPVPAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.77| 17| 18| 43| 59| 3
---------------------------------------------------------------------------
43- 59 (33.61/22.66) YLKYWQRPEYIKYIMYP
64- 80 (29.16/18.75) FLELLQNANFRNAMAHP
---------------------------------------------------------------------------
|