<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17940
| Description |
Uncharacterized protein |
| Sequence | MLERLITFLQVSKNNITPNFKEKLGFYEKQIVGFVNPSRYRKPIPNLQQGQPPQPHIQPMQQPQSQVPQLQSHENQLNPQLQSMNMQGSVPKMQQNNMSSLLHNSLSTLSGDSTSQSNMMNPIQPGSNLDSGQGNALSSLQQTPVGSVQQNLVSISQPTNVNTMSTQSGMLQTQQLKRLQQRQNLMQNQQMLQQQQLHQQAKQQLRAQMQTHQIPQPQQMNDVNEMRQGIGIKPAVFQQHLPTGQRTAFPRQHMKPAPSFPISSPQLPQHASPQLQHSSPQIDQQNLPSSVTKTGTPLQSANSPFVVPSPSTPLAPSPMPGDSDKPVSGISSILNTGNIVHQPSVAQAQAPSLAVGTPGISASPLLAEFTSPDGAHGGALTTVSSKSNVTEQPLK |
| Length | 395 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.684 |
| Instability index | 72.38 |
| Isoelectric point | 9.99 |
| Molecular weight | 43005.01 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17940
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.50| 20| 20| 170| 189| 1
---------------------------------------------------------------------------
47- 64 (29.35/ 8.44) .LQQGQPPQPH.IQPMQQPQ
170- 189 (32.98/10.61) MLQTQQLKRLQQRQNLMQNQ
191- 207 (28.17/ 7.73) MLQQQQLHQ.QAKQQL..RA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 132.19| 30| 30| 250| 279| 2
---------------------------------------------------------------------------
250- 279 (56.15/19.47) PRQHMKPAPSFPI......SSPQLPQHASPQLQHSS
297- 324 (45.86/14.70) PLQSAN.SP.FVV......PSPSTPLAPSPMPGDSD
343- 376 (30.18/ 7.44) PSVAQAQAPSLAVgtpgisASPLLAEFTSPDGAH..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 110.04| 29| 30| 97| 125| 3
---------------------------------------------------------------------------
72- 112 (31.36/10.86) ..SHENQLNPQLQsmnmqgsvpkmqqnNMSSLLHNSLSTLSGD
113- 143 (44.92/18.70) STSQSNMMNPIQP............gsNLDSGQGNALSSLQQT
146- 169 (33.76/12.25) GSVQQNLVSISQP..............TNV....NTMSTQSG.
---------------------------------------------------------------------------
|