<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17937
Description |
Uncharacterized protein |
Sequence | MPCPLPPWIQQHPIVCPLKFRIKGCFSLSYCPQISLRHVSSWVSQNMQNCMASNGVQSYAGLQAAPPPVSGVTQTIPNTVVQNPNMQSIPGVSQNSVGNSMGQGIPSTMFANSQRQMPASLDSTAQTGHANGADWQEEIYQKIKVMKKTYFPEINEMYQRIAAKLQQLDSLPQQPKSEQLEKLKVFKAMLECLITFLQVSKNNITPSFKEKLGSYEKQIVSFLKPSRFRRSIPNLQLGQLPQPHVQPMQQPQSPVPQLQSHENQLNPQLQSLNVHGSIPTMQQNNMSSLQHGSLSSLSGVSMSQSITMMRDERF |
Length | 314 |
Position | Tail |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.455 |
Instability index | 63.54 |
Isoelectric point | 9.42 |
Molecular weight | 35059.93 |
Publications | PubMed=16973872
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17937
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.52| 13| 15| 268| 281| 1
---------------------------------------------------------------------------
268- 281 (19.81/16.56) QLQSLNvHGSIPTM
285- 297 (22.71/13.78) NMSSLQ.HGSLSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.80| 10| 17| 81| 90| 2
---------------------------------------------------------------------------
81- 90 (20.06/ 9.69) VQNPNMQSIP
97- 106 (19.74/ 9.43) VGNSMGQGIP
---------------------------------------------------------------------------
|