<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17936

Description Uncharacterized protein
SequenceMQFLILVYVNFAFQHDPLPQQPKSEQLEKLKLFKVMLERLIGFLQVPKNNITPNFKEKLGSYEKQILGFLNPSRYRKPIPNLQQGQLPQPHIQPMQQPQSQVPQLQSHENQLNSQLQSINMQGSVPKMQQNNMSSLLHNSLSTLSGDSTSQSNMMNPIQPGSNLDSGQGNALSSLQQTPVGSVQQNLVSISQPTNVNTMSTQSGVSMMQPNMPLQSNSNMIQHQHLKQQQQHEQHMLQTQQLKRMQQRQNLMQNQQMLQQQQQLHQQAKQQLPAQMQTHQIPQPQQMNDVNEMRQGIGIKPAVFQQHLPTAQRTAFPRQHMKPAPSFPISSPQLPQHASPQLQHSSPQIDQQNLPSSVTKTGTPLQSEQPLERLIKAVKSLSPKALSASVGDIGSVVSMIDRIAGSAPGNGSRAAAGEDLVAMTKCRLQARNYITQDGMTGSRKMRRHTSAMPLNVVSSAGSVSDSFKQFTGPETSDLESTATSSVKRPRIEANHALLEEIREINQRLIDTVVDISDEDVDSTAVAATAEGGEGTIVKCSFSAVALSQNLKSQYASAQMSPIQPLRLLVPTNYPSCSPILLDRFPVEVSKEYEDLSIKAKSRFSISLRSLSQPMSLGEIARTWDVCARVVISEHAQQSGGGTFSSKYGSWENCLSAA
Length657
PositionTail
OrganismPopulus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
Aromaticity0.04
Grand average of hydropathy-0.559
Instability index61.11
Isoelectric point9.26
Molecular weight72625.54
Publications
PubMed=16973872

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17936
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     151.70|      28|      28|     215|     242|       1
---------------------------------------------------------------------------
  117-  144 (35.54/11.18)	QS.INM.QGSVPKMQQN.......NMSSLLHNslSTL
  215-  242 (54.51/21.09)	QSNSNMIQHQHLKQQQQ.......HEQHMLQT..QQL
  246-  272 (34.74/10.77)	QQRQNLMQNQQMLQQQQ.....qlHQQ...AK..QQL
  336-  369 (26.90/ 6.67)	QHASPQLQHSSPQIDQQnlpssvtKTGTPLQS..EQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     168.09|      44|     244|      45|      88|       2
---------------------------------------------------------------------------
   45-   88 (78.65/42.65)	QVPKNNITPNFKEKLGSYEKQILGFL.......................................NPSRYRK................PIPNL..QQGQ......LP
   96-  176 (36.84/15.74)	QQPQSQV.P....QLQSHENQLNSQLqsinmqgsvpkmqqnnmssllhnslstlsgdstsqsnmmNPI...Q................PGSNL..DSGQgnalssLQ
  280-  335 (52.60/25.89)	QIPQPQQMNDVNEM.....RQGIG.I.......................................KPAVFQQhlptaqrtafprqhmkPAPSFpiSSPQ......LP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.15|      14|      15|     180|     193|       3
---------------------------------------------------------------------------
  180-  193 (24.24/13.22)	VGSVQ.QNLVSISQP
  196-  210 (21.91/11.21)	VNTMStQSGVSMMQP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17936 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KPIPNLQQGQLPQPHIQPMQQPQSQVPQLQSHENQLNSQLQSINMQGSVPKMQQNNMSSLLHNSLSTLSGDSTSQSNMMNPIQPGSNLDSGQGNALSSLQQTPVGSVQQNLVSISQPTNVNTMSTQSGVSMMQPNMPLQSNSNMIQHQHLKQQQQHEQHMLQTQQLKRMQQRQNLMQNQQMLQQQQQLHQQAKQQLPAQMQTHQIPQPQQMNDVNEMRQGIGIKPAVFQQHLPTAQRTAFPRQHMKPAPSFPISSPQLPQHASPQLQHSSPQIDQQNLPSSVTKTGTPLQSEQPLERL
77
374










Molecular Recognition Features






MoRF SequenceStartStop




NANANA