<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17925
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MKLCLSLYRVLHWQPNAGTTVNTQILNEVTQCVESINGVKEGRWKATVTYYKPILRDQSQAPELPRDFLGISLPEQPNKYYFIIRGQRIVLEADSSIQTIMEKLQSYKSRVALYFEGFQYQLGDFQLRVGKVTPTHSDNLRGIIMEVEYLPLSSIDKSRQVMEEFVDIWQEAISKRSLPGHFMHMEPNFVEYGLSDHYSSQHTAVQYATVMAQLIATQSVQAARN |
Length | 225 |
Position | Head |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.318 |
Instability index | 42.64 |
Isoelectric point | 6.60 |
Molecular weight | 25898.28 |
Publications | PubMed=16973872
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17925
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.90| 21| 28| 12| 34| 1
---------------------------------------------------------------------------
12- 34 (33.46/35.31) HWqpNAGTTVNTQILNEVTQCVE
43- 63 (38.44/31.07) RW..KATVTYYKPILRDQSQAPE
---------------------------------------------------------------------------
|