| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPLKWVLHWQPNAGTTVNTQILNEVTQCVESINGVKEGRWKATVTYYKPILRDQSQAPELPRDFLGISLPEQPNKYYFIIRGQRIVLEADSSIQTIMEKLQSYKSRVALYFEGFQYQLGDFQLRVGKVTPTHSDNLRGIIMEVEYLPLSSIDKSRQVMEEFVDIWQEAISKRSLPGHFMHMEPNFVEYGLSDHYSSQHTAVQYATVMAQLIATQSVQAARN |
| Length | 221 |
| Position | Head |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.351 |
| Instability index | 44.73 |
| Isoelectric point | 6.31 |
| Molecular weight | 25445.71 |
| Publications | PubMed=16973872 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP17924
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.90| 21| 28| 8| 30| 1
---------------------------------------------------------------------------
8- 30 (33.46/28.80) HWqpNAGTTVNTQILNEVTQCVE
39- 59 (38.44/25.32) RW..KATVTYYKPILRDQSQAPE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) YYFII 2) YYKPILR | 76 46 | 80 52 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab